SKU: 65522343487

DDB1/CRBN Complex, Flag&His Tag, Human

$162.00 $180.00
Save 10%
No.2 Bestseller on thhungvuong.edu.vn >

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 10 - Jul 15

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

DDB1/CRBN Complex, Flag&His Tag, HumanProduct Specification Species Human Synonyms DDB1 CRBN Complex Accession Q16531Q96SW2 Amino Acid Sequence DDB1 Flag Tag, Human Met1 His1140

Product Specification


Species Human
Synonyms DDB1/CRBN Complex
Accession Q16531、Q96SW2
Amino Acid Sequence

DDB1 Flag Tag, Human
Met1-His1140
DYKDDDDKMSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLLFILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNIRLEELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESITYHNGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYLDNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHASIDLPGIKGLWPLRSDPNRETDDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVRLVSQEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVACLDITPLGDSNGLSPLCAIGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRTFRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPLYESPRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSSTAPHETSFGEEVEVHNLLIIDQHTFEVLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEEAEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFNGKLLASINSTVRLYEWTTEKELR
TECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAVEILDDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGETSTPTQGSVLFGTVNGMIGLVTSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDGSGMKREATADDLIKVVEELTRIH
CRBN His Tag, Human
Met1-Leu442
HHHHHHHHGGGSGGGSMAGEGDQQDAAHNMGNHLPLLPAESEEEDEMEVEDQDSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDDDSCQVIPVLPQVMMILIPGQTLPLQLFHPQEVSMVRNLIQKDRTFAVLAYSNVQEREAQFGTTAEIYAYREEQDFGIEIVKVKAIGRQRFKVLELRTQSDGIQQA
KVQILPECVLPSTMSAVQLESLNKCQIFPSKPVSREDQCSYKWWQKYQKRKFHCANLTSWPRWLYSLYDAETLMDRIKKQLREWDENLKDDSLPSNPIDFSYRVAACLPIDDVLRIQLLKIGSAIQRLRCELDIMNKCTSLCCKQCQETEITTKNEIFSLSLCGPMAAYVNPHGYVHETLTVYKACNLNLIGRPSTEHSWFPGYAWTVAQCKICASHIGWKFTATKKDMSPQKFWGLTRSALLPTIPDTEDEISPDKVILCL
Expression System Baculovirus-InsectCells
Molecular Weight

128&53kDa (Reducing)
Purity ＞95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tags & Cleavage sites Flag Tag; His Tag
Physical Appearance Liquid
Storage Buffer 20mM Tris,300mM NaCl,10%Glycerol,1mM DTT, pH7.5.
Stability & Storage

·12 months from date of receipt, -20 to -70 °C as supplied.
·1 month, 2 to 8 °C under sterile conditions after reconstitution.
·Please avoid repeated freeze-thaw cycles.
Reference

Fischer E.S.,et al. (2014) Nature 512: 49
He Y.J., et al. (2006) Genes Dev. 20: 2949
Ito T., et al. (2010) Science 327: 1345
Wang H., et al. (2006) Mol. Cell 22: 383

Background

Cereblon (CRBN) is the substrate recognition component of DCX (DDB1-CUL4-X-box) E3 Ubiquitin ligase complexes that mediate the ubiquitination of numerous target proteins including the transcriptional regulator MEIS2. CRBN plays an important role in limb outgrowth, and its function in this process is perturbed by the binding of thalidomide and related compounds. Binding of CRBN to Cullin-4 is mediated in part by DNA damage-binding protein 1 (DDB1), a component of multiple DCX class ligases. In addition to its role in limb development, DDB1 is also involved in various DNA damage response mechanisms. This product consists of an untagged complex of DDB1 and CRBN.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 65522343487

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 383 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
W
Verified Purchase
Whitney Atkinson
Alexandria, US
★★★★★ 4
Diverse, hilarious, and fun
Format: Paperback
This was soooo fun, and what it lacked in patchy storytelling made up for in its incredible art and lovable characters. The main character is latina, fat, and queer, the love interest is black and queer (yes, it's f/f romance!), and the prominent side character is non-binary, queer, and literally a mix of kenji and kuzco from the emporer's new groove (they were SO sweet but funny and definitely my favorite part of the book). Not to mention all of these characters are mythological creatures! I loved reading the characters' interactions because the banter was so cute and fun, both platonic and romanticly. The action began to get a bit confusing toward the end and I wish it was explained better what was happening, but I loved the world building and the characters' relationships with each other so I'm definitely continuing this series.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 30, 2019
K
Verified Purchase
K. Rogers
Charlottesville, US
★★★★★ 5
Love it
Format: Kindle
Very cute, the plot is great, and the art is amazing I just love this book. It is one of my favourite graphic novels
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 7, 2021
C
Verified Purchase
courtney
Chelsea, US
★★★★★ 3
the art is great and really helps to set the scene of this ...
Format: Paperback
It's cute book. the art is great and really helps to set the scene of this magical world. I took issue with the characters and the narrative. The main character is a werewolf who is very self conscious about it but it's never really clear since apparently, there are not only plenty of werewolves but also people who can shift into other animals. Her best friend is a centaur who I found a little grating with his "lol XD so random" personality. I didn't find much fault with the girlfriend character but I didn't understand their relationship. the main character starts the book having had one date with her girlfriend they seem to have some issues (over what I thought was very minor things) and decide at the end of the book to go to couple's therapy to solve them but like, they weren't together for that. I assume maybe a month has passed, just break up. I just didn't understand that. The narrative itself didn't seem tight. One character has cryptic visions that didn't really seem to pan out or really have the gravity she seemed to put to them. there is a meta narrative involving a book the main character likes and the events in that book mirror the events in the comic but I didn't really see it that strongly and it seemed to have little use. The main conflict seems to be solved very quickly and with little fanfare. All in all, it's not a bad book. i just found it a bit weak. It's not amazing, nor above average. But it's also not garbage or terrible. It's won't have the greatest of appeal but I'm not upset I bought it and it's not a waste of time. However, I wouldn't read any additional work of this series.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 1, 2018
K
Verified Purchase
Kendra
Charlottesville, US
★★★★★ 5
Obsessed
Format: Kindle
I really hope there will be more of this comic coming soon. It was so well thought out. The colors were incredible. The fluidity of every character was great. Enjoyed this so very much.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 15, 2019
E
Verified Purchase
Elizabeth
Lake Worth, US
★★★★★ 5
Great book
Format: Paperback
I LOVE THIS BOOK. It’s supper cute and fun. The art work is great and so is the writing. I couldn’t find anything wrong with the book.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 18, 2019

recommand products

About this page Buying options $164.99 +$0.00 est. tax Delivery date & cost shown at checkout Spend
169.99
Ace 300 Metal Detector
130.00
Thrasher
36.99
Hatchet MT 3.8" Mounted 1/2" Offset Black Tires (2)
45.99
Better Builders Grippies 30 Piece Set
59.95